PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 562aa    MW: 60872.1 Da    PI: 6.0553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027189genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.4e-154390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++v+++G g+W+++ +  g+ R++k+c++rw ++l
      Lus10027189 43 KGPWTAAEDAILTEYVRRHGEGNWNSVQKNCGLMRCGKSCRLRWANHL 90
                     79******************************************9986 PP

2Myb_DNA-binding47.54.2e-1596139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+  +++++ ++G++ W++ a  ++ gRt++++k++w++
      Lus10027189  96 KGAFTPDEERVIIELHSKYGNK-WARMATQLP-GRTDNEIKNYWNT 139
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7243890IPR017930Myb domain
SuperFamilySSF466899.36E-3040137IPR009057Homeodomain-like
SMARTSM007175.1E-124292IPR001005SANT/Myb domain
PfamPF002495.2E-144390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-234497IPR009057Homeodomain-like
CDDcd001674.60E-104590No hitNo description
PROSITE profilePS5129426.09391145IPR017930Myb domain
SMARTSM007172.8E-1595143IPR001005SANT/Myb domain
PfamPF002495.8E-1496139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2598144IPR009057Homeodomain-like
CDDcd001674.70E-1198139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MMRNDVVEHG DEGGGGAGGA ATMVVMTGGG GGQRKGNLQG LKKGPWTAAE DAILTEYVRR  60
HGEGNWNSVQ KNCGLMRCGK SCRLRWANHL RPNLKKGAFT PDEERVIIEL HSKYGNKWAR  120
MATQLPGRTD NEIKNYWNTR MKRRQRAGLP MYPREFLDQT ASFHMQQRQQ QEHNFIDHNN  180
NIKPSSSLFS MFRKAPAPDY NPCNFSISAE KLTDFSSSAP GTGESYQGHN SHHSNLICAT  240
NHHQHQQYIN AQNGVVLGPL SLSPPVVSGF APPQQLIVFG QSSTSPAIDQ LHGGGGGGGG  300
GGGGESYPNN VISFTSLIMG DYEDHDVDQL ESFSFASASE LPSLQTPPRS ASSNAATSGV  360
GSGVCITVEE PDNANSKNNN NNNNGSEVVR DGNDDISHED SVLIGDNMVI RDNNSGMLDV  420
LLQESKSIMC RKRKADDREI SSPAGEDEGK RLCNPAMFRI AAGSNEQLAS DGGRWDPRDN  480
FMSSLGMEPV KEKATVMAPE EMSSTTMVDD DDLLSLLTNF PSSVPLPEWY HGHHHNTANN  540
YNNGNAYEIS GNGGGLGDHQ V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29411445107B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.17e-74myb domain protein 101